Baixe o app para aproveitar ainda mais
Prévia do material em texto
Vol. 176, No. 11JOURNAL OF BACrERIOLOGY, June 1994, p. 3257-3268 0021-9193/94/$04.00+0 Copyright C) 1994, American Society for Microbiology Transposon Tn5O9O of Plasmid R751, Which Carries an Integron, Is Related to Tn7, Mu, and the Retroelements PETER RADSTROM,1'2 OLA SKOLD,1 GOTE SWEDBERG,1 JOHN FLENSBURG,3 PAUL H. ROY,1 AND LARS SUNDSTROMl* Department of Pharmaceutical Biosciences, Division of Microbiology, Uppsala University, Biomedicum, S-751 23 Uppsala,' Applied Microbiology, Lund University, S-221 00 Lund,2 and Medical Products Agency, S-751 03 Uppsala,3 Sweden Received 16 November 1993/Accepted 19 March 1994 Integrons confer on bacterial plasmids a capability of taking up antibiotic resistance genes by integrase- mediated recombination. We show here that integrons are situated on genetic elements flanked by 25-bp inverted repeats. The element carrying the integron of R751 has three segments conserved with similar elements in Tn2l and Tn5O86. Several characteristics suggest that this element is a transposon, which we call TnSO9O. TnS090 was shown to contain an operon with three open reading frames, of which two, tniA and tniB, were predicted by amino acid similarity to code for transposition proteins. The product of tni4 (559 amino acids) is a probable transposase with 25% amino acid sequence identity to TnsB from Tn7. Both of these polypeptides contain the D,D(35)E motif characteristic of a protein family made up of the retroviral and retrotransposon IN proteins and some bacterial transposases, such as those of TnS52 and of a range of insertion sequences. Like the transposase genes in Tn552, Mu, and Tn7, the tnL4 gene was followed by a gene, tniB, for a probable ATP-binding protein. The ends of TnSO90, like those of most other elements producing D,D(35)E proteins, begin by 5'-TG and also contains a complex structure with four 19-bp repeats at the left end and three at the right end. Similarly organized repeats have been observed earlier at the termini of both Tn7 and phage Mu, where they bind their respective transposases and have a role in holoenzyme assembly. Another open reading frame observed in TnSO90, tniC, codes for a recombinase of the invertase/resolvase family, suggesting a replicative transposition mechanism. The data presented here suggest that TnS090, Tn7, TnS52, and Mu form a subfamily of bacterial transposons which in parallel to many insertion sequences are related to the retroelements. The genetic flexibility of plasmids is augmented by integrons (56), which are genetic systems for the mobilization of single resistance genes by site-specific recombination (8, 41, 57). The resistance genes acquired by integrons are organized as cas- settes with flanking GTT sequences and with short palindromic sequences adjacent to the 3' end of the genes. The 30 or so inserted cassettes occurring among the integrons form a vari- able region surrounded by conserved sequences in both direc- tions. The 5' conserved sequence contains the gene int, coding for a site-specific recombinase of the type defined by Argos et al. (2, 42, 57). This integrase is necessary for the uptake of resistance cassettes (11, 34). The segment 3' of the cassettes carries a qac gene for an exporter protein mediating resistance to antiseptics and disinfectants (45) and, in most studied integrons, the sulI gene for a sulfonamide-resistant dihydro- pteroate synthase (47, 57). The integrons occur on plasmids of different incompatibility groups, implying that they are borne on mobile elements, but the extent and organization of these mobile elements have not been characterized previously. We describe here in detail the element carrying the integron in the IncP plasmid R751. Several independent lines of evidence suggested that the element is a transposon, Tn5O90, which was mapped to a position very close to that shown earlier for Tn402 (54); the two transposons may be identical. The members of the Tn2l family of mercuric resistance transposons are known to carry an integron which makes them * Corresponding author. Mailing address: Department of Pharma- ceutical Biosciences, Division of Microbiology, Uppsala University, P.O. Box 581, Biomedicum, S-751 23 Uppsala, Sweden. Phone: 46-18-17 41 15. Fax: 46-18-50 27 90. confer a varied antibiotic resistance phenotype on their hosts. This integron is part of an internal element of Tn2J missing in some otherwise related mercury resistance transposons, e.g., TnS0J (7, 24). The internal element of Tn2l consists of 11 kb and resembles a transposon (here referred to as Tn5092) because it is flanked by 25-bp inverted repeats (IRs) with associated 5-bp direct repeats (7). Parts of Tn5092 are missing or substituted for in related Tn2l-like transposons. The corre- sponding element (called TnS093) of Tn5086, for instance, lacks a large segment downstream of sulI (60), which explains its smaller size (7 kb). By comparison of Tn5O90 of R751 with Tn5092 and TnS093, we observed both common and unique regions. The largest common region has not been studied previously and was found here to contain probable transposi- tion genes. The protein which is responsible for the cutting and transfer of DNA strands to move transposable elements is called transposase; however, often one or more auxiliary proteins are required for mobility (38). Some of these are suggested to promote essential contacts between transposition proteins and DNA, under binding of ATP (51). The degree of the multi- functionality of transposition proteins seems to vary among different mobile elements (38). At one extreme, those of Tn7 seem to be very specialized, as reflected in the four different proteins that are required to make Tn7 transpose (48). In contrast, Tn3 utilizes only one, very large transposase. One further recombinase of Tn3 belongs to a site-specific resolution system (55), which is explained by the need to separate the cointegrates formed by replicative transposition (53). Such a system seems unnecessary for transposons such as Tn7, which 3257 o n Septem ber 28, 2017 by guest http://jb.asm.org/ D ow nloaded from 3258 RADSTROM ET AL. is capable of cutting both donor strands and transposing directly by a cut-and-paste mechanism (3). Recently uncovered features of transposition proteins indi- cate that some bacterial transposable elements do in fact resemble those of eukaryotic cells (16, 31, 49). This rather subtle sequence similarity was observed by comparison of the transposase of TnS52 and those of a range of insertion (IS) elements with the IN proteins of retroviruses and the long terminal repeat-type retrotransposons (16, 49). A motif of acidic amino acids has been identified in the most conserved region, and there is evidence that these sustain both processing and integration of retroviral DNA (31). Those transposons and retroelements, with very few exceptions, furthermore have the same first two nucleotides at their ends. By these criteria, we found that Tn5O9O and Tn7 also belong to this greater family of transposons. MATERIALS AND METHODS Bacterial strains and plasmids. Eschenichia coli J53 (F- pro met) (50) was used as the host for conjugative plasmids, JM105 thi rpsL endA sbcB15 hspR4 A(lac-proAB) F'[traD36 proAB+ lacIqZAM15] was used as the host for M13mpl8 and -19, and JM83 araA(lac-proAB)rpsL 4801acZAM15 was used for pUC18 and -19 (65). Plasmid clones were made in pUC18/19 (65). Resistance plasmids and derivatives used were R388 and pSa (64), R751 (44), pLMO20 (57), pLMO229 (59), N3 (6), pBR322::Tn2l, and pBR322::TnSO86 (60). Subclones for se- quencing of Tn5090 were made from pLKO603 (the 8.5-kb PstI fragment from R751 including the dhfrIIc gene, cloned in pUC19). Clones used for sequencing Tn2l and Tn5086 were described earlier (60). Materials. Media used were Iso-Sensitest (Oxoid, Basing- stoke, United Kingdom), LuriaBertani broth, mineral salts medium M9, and double-concentrated YT broth (50). T4 DNA ligase was from New England BioLabs, Inc., Beverly, Mass., and other enzymes were from Boehringer GmbH, Mannheim, Germany. The isotopically labeled compounds used were [a-35S]dATP and [ot-32P]dCTP (New England Nuclear, Dreieich, Germany). Methods. The nucleotide sequences of R751 and R388 indi- cated in Fig. 1 were determined from both strands. Most of this sequence was obtained from randomly cloned re- striction fragments, but as a complement we utilized the following integron-specific oligonucleotides as sequencing primers: 5'- CGAGATIGGTGCAGATCAC`17CTG-3' (292 to 315 in Fig. 2) 5'-CAGGGCGGCCI Gl TllTCGGA-3' (positions 1351 to 1371), 5'-TIGCTATCACATGGAGGAGCC-3' (3025 to 3045), 5'-TCTCGGGGTTGTGTCGCGCT-3' (3964 to 3983), 5'- GGCTGTGAGCAATTATGTGC1TAGT-3' (5500 to 5524), 5'- TACGCAGCAGGGCAGTCGCCCTAAA-3' (6268 to 6292), 5'-GCGCCGTTACCACCGCITGCGTT-3' (6413 to 6434), 5'- GACGCACACCGTGGAAACGGAT-3' (6530 to 6551), and 5'-GGATCCAACCCCTCCGCTGCTA-3' (7542 to 7563). The last unresolved region was characterized by automated sequenc- ing, for which we used the primers 5'-TGGAGCAGGTGCA GATAGACCATACG-3' (positions 884 to 909) and 5'-AT GATCCGTTCCACGATGCCGCCATAGT-3' (1244 to 1271). Most of the sequencing was done with autoradiographic detection of radioactive labeling; however, a minor part was performed with fluorescein-labeled primers, the AutoRead Sequencing kit, and the ALF DNA Sequencer (Pharmacia LKB Biotechnology). Sequence analysis was assisted by using a Vax-8200 computer, a GraphOn 250 graphic terminal, and the Genetics Computer Group software package (14). Oligonucleotides were automati- cally synthesized in a Gene Assembler Plus and chromatograph- ically purified by using the FPLC system or the SMART system (Pharmacia LKB Biotechnology AB). Incompatibility determina- tion ofpLMO20 was done by transformation into J53(N3) (6) and selection on plates containing 0.1 mg of trimethoprim per ml. After restreaking of colonies several times on the same medium, the absence of the N3-specific marker gene, aadA2, was checked on plates containing 20 ,ug of spectinomycin per ml. Agarose and polyacrylamide gel electrophoresis and hybridizations were per- formed essentially as described earlier (50). Probe fragments were labeled by chain elongation primed by randomized hex- anucleotides with [tx-32P]dCTP as the labeling component. DNA sequencing was performed according to the dideoxynucleotide- chain termination method (52). Nucleotide sequence accession number. The nucleotide se- quences reported in this paper have been assigned accession numbers X12868, X12869, X58425, X72585, U09049, and U09050 in the EMBL, GenBank, and DDBJ data bases. RESULTS Characterization and nucleotide sequence of the integron element TnSO9O in R751. Restriction endonuclease mapping predicted more extended similarities between Tn2J and R751 than those noticed earlier (Fig. 1) and indicated that R751 could carry a segment corresponding to the internal 11-kb element of Tn2l. This segment of R751 would have a location very similar to that of Tn4O2, described by Shapiro and Sporn in 1977 (36, 54). The size of Tn4O2 was originally reported to be approximately 7.5 kb, and it was roughly mapped to include the leftmost BamHI site in Fig. 1, but not the Sall site to the far right (36, 54). It was not established whether Tn4O2 is identical to the element of Tn5O9O described below, but it seems very likely. An 8.3-kb PstI fragment from R751 was cloned and se- quenced (Fig. 1 and 2). The analyzed sequence covered the region of predicted homology with Tn2l. It was observed that 25-bp IRs identical to those flanking the 11-kb element in Tn2l, flanked a 7.40-kb segment in R751. These IRs are referred to as IRi for the integrase end and IRt for the opposite end (Fig. 1 to 3; see Fig. 6). The 7.40-kb element, called TnS090, was surrounded by sequences that were different from those bordering the 11-kb integron-element (Tn5092) of Tn2J (see Fig. 6) (7), indicating a distinct location. The internal sequences were largely identical. TnS090 carried segments of 1.4 kb at the left end and 2.7 kb at the right end which were identical to those of TnS092 or its smaller relative TnSO93. We sequenced random fragments of Tn5092 covering about 60% of its 2.7-kb region without observing any divergent nucleo- tides (Fig. 1). In addition to the major conserved parts, there was conservation of the exporter gene qacE (45), in the middle of TnSO90. Between qacE and the flanking conserved segments of TnSO9O there were unique sequences of 0.7 kb to the left and 2.3 kb to the right. The 3' conserved segment of integrons is an immobilized cassette. The left 1.4-kb segment of TnSO9O (Fig. 1) carries the integrase gene, int, which is related to the uptake of cassettes and which has been studied previously for other integrons (42, 57). Only two nucleotide differences from the corresponding part of Tn5093 (60) were observed, and these made the hexamers of the main promoter (TTGACA and TAAACT) of the operon of cassettes more similar to the E. coli consensus. TnSO9O contains two tandemly inserted cassettes. The cassette proximal to the promoter contains the dhfrIIc gene (17), which encodes a dihydrofolate reductase of type Ilc. The cassette resembles the dhfrIIb cassette in R388 (8, 57, 62) with a 60-bp insertion 3' of the gene in R751 as a notable difference. The J. BACTERIOL. o n Septem ber 28, 2017 by guest http://jb.asm.org/ D ow nloaded from TRANSPOSON TN5090 OF PLASMID R751 3259 #6 #1 #2 #3 #4 #5 F H H H H H II V H H H A " H H H d I I IV IRt Il -I--2.3kb-- 2.7 F1 H H H H H lo o H it i % I. .I I. E aI 11 -I IY lII --> _- IRi int aadAl qacEAl sulI AI mow m Y H HH H H )IIIII_4 -. L I I > IRi int dhfrVII qacEAl sulI HH HH H H H H H ~H H i tt H m. e0 I.0 ' . 1f 1 -_ -D - -_ IRi it dhfrIIb qacEAl sulI orfA I IRt 2.7 k- H H y 5kb FIG. 1. Maps of the regions containing integrons in plasmids R751 and R388 and in transposons Tn2l and Tn5O86. Sequences that are identical in TnSO92 and at least one more instance are indicated by heavy lines. Horizontal bold arrows, genes previously known; and unfilled arrowheads, genes borne on a cassette. Nucleotide sequences determined in this paper are underlined; sequences that are underlined and marked with letters are from other sources as follows: A, reference 57; B, reference 62; C, reference 17; D, reference 45; E, reference 27; F, reference 60; and G, reference 7. The conserved region of 2.7 kb to the right is boxed by a continuous line, and the 2.3-kb region unique to Tn5O9O is boxed by an interrupted line. It should be noted that the tnp and mer ends of Tn21 and Tn5O86 occur far outside IRi and IRt, respectively, and are not shown. cassette downstream of dhfrIIc contained an unidentified open reading frame (ORF) (orfD; Fig. 3) that was found previously in other integrons (39, 56). Downstream of these movable cassettes and located on a 0.4-kb conserved segment, TnSO9O harbors an exporter gene, qacE, mediating multiresistance (45). The corresponding qacEAl of TnS092 and Tn5O93 (57, 60) mediates less efficient export because of a 3' truncation of qacE which was generated by the insertion of sulI (45). The sulI gene has so far been exclusively found on integrons (47); however, the mechanism for its insertion into qacE is unknown. The absence of sulI in R751 revealed an 8-bp sequence downstream of qacE (GTTA GATG in Fig. 2), which is an IR of the recombination core sequence upstream of this gene (CATCTAAC in Fig. 2). IRs at these positions are found in all known cassettes (25, 26a) and indicated that qacE is borne on a cassette. There was also sequence similarity further 3' of qacE to a part of thosestem-loops found downstream of other cassettes (similarity ends at no. 6 in Fig. 1 and 2) (8). The idea that qacE has a different origin than the 5' conserved segment was further supported in that its codon usage (23) (Fig. 4) differed markedly from those of all other ORFs in TnSO9O. TnSO90 carries transposition genes. The conserved segment of 2.7 kb to the right in TnSO9O was observed to carry two ORFs, tniA and tniB, which were predicted to have functions connected to transposition (Fig. 2 and 3). A third ORF, orf6, follows just after tniB in TnSO90 but is absent in Tn5O92 and Tn5093. All three ORFs seem to be transcribed from a common promoter (Fig. 2). The orf6 indicated by its codon preference a good likelihood of being translated in E. coli (data not shown); however, the 405-amino-acid product could not be identified by comparison with protein sequences in the data bases. Probable functions of the gene products of both tniA and tniB, however, could be identified. The tniA gene, directed inward from the right terminal IR (IR,), was found to be a gene for a basic 559-amino-acid protein which is likely to be a transposase (Fig. 2) because of its approximately 25% amino acid identity to both tnsB of Tn7 and P480 of TnS52 (Fig. 5). R751 (Tn5090) #7 IRi int dhfrIIc \qacE orfD #8 .I H H H H H H H H 7:t'A: eX8 Z 'S m *S a Y I (( H H H H H H H H t lat Ica: ZY. V I(( Tn2l (Tn5O92) Tn5O86 (T5093) R388 N~~~~~~~~~~ Il d H H 4J 14 M VOL. 176, 1994 o n Septem ber 28, 2017 by guest http://jb.asm.org/ D ow nloaded from J. BACrERIOL. PstI .. . ScI .. Sai CT,GCAGCATCGCCATT,GCCGACG;ATGGCACCAGGTCGCCGGCGGTIGGCCACCGACCTCGACGCTCGCCACATICCACGA7CGCGCGGCGTCG;ACCATCGCCAGG,TCTIGACG. NotI .. ** t GCGGCCGCCCTGCCCTGGATCTCGCATCGCCArIs:TGGCGAT,GAGATCCACGGAGCGGCCATlwAGACCCGCCAATAA,CGACCCGGCCAAGAT!CA IRt 3 p -1 . t3 RBH. GTTIGA7TGGGCGTAATIGGC7GT,GXLAGCCAGCTCCTGACAG=AAZTCAGAAGTGATCTGCACCAATCTCGACTATG,CTCAATACTCGTGTGCACCAA&GC AWIGCAMT -35 p_> -10 RBS X ----- - - - - -.---.-.-.-.-kTTCCtAGAAAAGGCGraGCACTl I P E Q G V A T XCGGCTCAGGCCICTGGCT17TCT A A Q A L G L S 3GGCGCTTGCCGGAACCGGTCGAG G R L P E P V E :AAAAACTr,CGAGT%2CCGGCGCGC Q K L R V P A R 3CGACGCCTCCTGCCGTGACCGCG G E P P A V T A ;CCATCGACGTGTTCACCCGCTG3C A I D V F T R C 3GACTGAACGTGGAAATGGATTGG G L N V E N D W :TGGACTATCGCCCGCT3GGGACAG L D Y R P L G Q 'GCGGCGACTACGATTCCGAAAAC R G D Y D S E N L P D A W ACCI 00CGCCAGGTATACGTT' R R Q V Y V &GCGTCATCCACGAGCTA R V I H E L iATACCGT0GCCTTACGG0 N T V A L R CCTG13GAGCAOGTGCAG P L E Q V Q GTGCTCGGCATGGTCGTC. V L G M V V &AGATGAGCGGCAAGCCC' Q M S G K P CCGCACTAlfGCGGCATC P H Y G G I iAGGcCGCCCTGACGCTm K A A L T L E R CT6ATC L I ,C76CAA L Q ,ATCGCT I A ATAGAC I D ACGCTG T L GCTG L L GMGMAA V E CGCGAG R E A R R CGGCGT&CC R R A AAGCGGTTC K R F AGCCTTI6AC S L D CATACG&TC H T V GAAGCGCCG E A P CWTACCTA L Y L CGGATCiTO R I I CTAGAGCGC L E R R A E I I S P L CGGCAAGGCAGCGGCCTCGTGACG R Q G S G L V T CGACCAAGCAGAAGCGCAGCCTA L T K Q K R S L CCGCGCAAGGTCATCCGCCGGCGG P R K V I R R R kTCGACCTGATCGTGGTCGATGAC I D L I V V D D ICTGCCGTTTCGGTTGGCCTGTGC S A V S V G L C ;ACAACGCGGCCGAGTTCAAGAGC D N A A E F K S 0GCACGGCGATGCAGATGATTCAC G T A M Q M I R rGGCTCACATT0;GCGGTCGGCACC W L T L A V G T A Q S GAT6TGGTG D L V GCGGCCTTT A A F GAAGGCCAG E G Q CGCGACCGG R D R CTCGTGCAT L V H DraII GAGGCCCTG E A L GACGAACTG D E L TACCACGGT Y H G IA C c c C AT1 -4 star ;GCG A CA& E T V G H ;CCCGGCCAGTCCGGT P G Q S G rCACCGCGAAGTCACT H R E V T ;GATGCCGCTCGTGAC D A A R D ICAACCTAT'rGGCCGC Q P I G R rTcGCCTGCGACAAG V A C D K ;CCCGGGGTTGCGAG R R G C E ;CCGGGAACGACCTTC P G T T F rTCGTGCACAACGGC S V H N G CTG,CTCCAACCGCCGGCCGCGCGCTGAGGCCGTGGCCGGGrCGTIGT,CGGCGTACCGGCCGTCGTCACACGCGCTACTTCGTTCCT ;GTCGATTlT£TtCTCCGATCCTCCGGCGCACGCT,G LL Q P P A A R W A E A V A R V G V P A V V T R A T S F L V D F L P I L*R R T L ACCCGCACCGGCTTTIGTCATCGACCACATCCACTACTACGCCGATGCGCTCAAGCCGTIGGATT,GCGCGGCGTGAACGCTGGCCGTCCTYYsTGATCCGGCGCGAT,CCGCGCGACATCAGC T R T G F V I D N I H Y Y A D A L K P W I A R R E R W P S P L I R R D P R D I S Drall CGTATITCTGGGTCCTIGGAACCGGAGGGACAGCATTACCTIGGAAATTCCCTACCGTACCTTI"GTCGCATCCGGCT,GTCACCC'TGGGAACAACGGCAGCGCGC7'GGCGAAACTIGCGGCAGCAA R I W V L E P E G Q H Y L E l P Y R T L S H P A V T L W E Q R Q A L A K L R Q Q GGGCGCGAACAGGTGGATGAGTCGG;CGCTGTTCCCATOATCGGCAGATGCGTGAT7GACCAGCGCGCAGAAGGCCACACGCAAGGCGCGGCGTGACGCGGATCGCCGCCAGCAC G R E Q V D E S A L F R H I G Q M R E X V T S A Q K A T R K A R R D A D R R O H start tniB - stop tniA - I CT,CAAGACATCAGCTCGGCCGGACAAGCCCGTTCCGCCGGATACGGATATTGCCGACCCGCAGGCAGACAACTT-GCCACCCGCCAAACCGTTCGACCAGATTGAUAQTG]fTAGCCGTGG L K T S A R P D K P V P P D T D I A D P Q A D N L P P A K P F D Q I E E W M RBS ACGAATATCCCATCATCGACCT,GTCCCACCTGCT,GCCGGCGGCCCAGGGCTTGGCCCGTCTTCCGGCGGACGAGCGCATCCAGCGCCTTCGCGCCGACCGCT,GGATCGGCTATCCGCGCG D E Y P I I D L S H L L P A A Q G L A R L P A D E R I Q R L R A D R W I G Y P R SphI. CAGTCGAGGCGCTGAACCGGCT,GGAAGCCCTTTATGCGT,GGCCAAACAAGCAACGCATGCCCAACC7GCGCTlGGTITGGCCCGACCAACAATGGCAAGTCGATGATCGTCGAGAAGTTCC A V E A L N R L E A L Y A W P N K Q R M P N L L L V G P T N N G K S M I V E K F GCCGCACCCAiCCCGGCCAGCTCCGACGCCGiACCAGGAGCACATCCCGGTGTTGGT,CGTGCAGAT,GCCGTCCGAGCCGTCCGTGATCCGCTTCTACGTCCGCTGCCGCCGCGATGGGCG R R T H P A S S D A D Q E H I P V L V V Q M P S E P S V I R F Y V A L L A A M G SphI. CGCCGCTGCGCCCACGCCCACGGTTGCGAGACACC,7MCTGCT_GCGCAAGGTCGGCGTGCGCATG;CTGGTGATCGACGAGCTGCACAACGTGriCGGCCGGCAACA A P L R P R P R L P E M E L A L A L L R K V G V R M L V I D E L H N V L A G N EcoRI. GCGTCAACCGCCGGGAATTCCTCAACCTG,CTGCGCTTCCTGCACGAATTGCGCTTGGTGGAGGGAGCACTGCT CGCTCCGATGACCAGTG S V N R R E F L N L L R F L G N E L R I P L V G V G T R D A Y L A I R S D D Q L AAAATCGCT+CGAGCCGATGAT,GCTGCCGGTATGxGGAGGCCAACGACGTTGCTGCTCACl7GCTAGGCCAGCTTCGCmCCGllxCCGC'GMCCGGCCTTCCCCAATTGCCACGCTGG E N R F E P M M L P V W E A N D D C C S L L A S F A A S L P L R R P S P I A T L ACATGGCTCGCTACCT,GCTC&ACACGCAGCGAGGGCACCATGGACGCCC GTGTGGCGCATCGTCGCCGTGGAGAGCGGCWACGAGGAAG CTGAA DM A R Y L L T R S E G T I G E L A H L L M A A A I V A V E S G E E A X N H R T -+ start orf6 .*t7 . . . * stop tniB - TCAGCATGGCCGTTTACACCGGACCCC ATCiTTAGCTGCGCCCGCTGGCWCGCTGCATCCCGCCCCGAAAGAAGGCGAGGCGCTGTC L S M A V Y T G P S E R R R Q P E R E L H * RBS M K P A P R W P L H P A P K E G E A L S CTCAT,GGCTCAACCGCGTGGCCCTTT13CTATCACAT,GGAGGAGCGACCcATGGAGTTGTAGcAGTAG TGCGCACCACTCTCGCTACCTGc S W L N R V A L C Y H SE E P D L L E N D L G H G Q V D D L D T A P P L S L L A GCrCCAGGAGCGGATcGAGc,mGAcTGGTGAGcTGTAcGGTGcGrTGGAc,GTAGcTT,GAGcTC74"ACTTGATGA CCAGA TTCCAGACGCCTTTGGAAACCTA L L S Q R S G I E L D R L R C M S F A G W V P W L L D S L D D Q X P D A L E T Y TG,CGTTTCAGCTCGGTrGTTGCTGCCAAGACTCCGCCGTAAGACGCGATCCATCACGAGClnGCGTG;CC:G7CCCAGCCAGCCGATAAACCGCGCCT,GTCCGoCT4CIsCCTIGAGCGA A F Q L S V L L P R L R R K T R S I T S W R A W L P S Q P X N R A C P L C L S D TCCGGAGAACCAAGCCGTAC7GCT,CGCG7GGAAGCTGCCCCTGATGCTGAGCTGCCC _CTG7GTGTGATCTA7GGGGCGT,GCCAGGGCGG SrA P E N Q A V L L A W K L P L M L S C P L H G C W L E S Y W G V P G R P L G W E N CGCCGACGCCGAACCGCGCA,CCGCCAGCG'ACGCGAT,X;CGGCGATGGACCAGCGTACCTCTGAGATGACAACCGGTCACGTGGAGCTC7CGCGCCGACGCATCCACGCCGGATTGTG A D A E P R T A S D A I A A M D QR T W Q A L T T G H V E L P R R R I H A G L W GTTTCGAC7TCVCCACGCrTCGATGAGCTGAACACCCCGCTTTCCGCGTGCGGAACCTG,CGCGGGGTATCCCCGCCAAGGCWGAAGGC'lr7CGGCTCCxCMGCTGGGGCA P R L L R T L L D E L N T P L S A C G T C A G Y P R 0 V W E G C G H P L R AG AAGTCTGTGG6CGACCGTATGaAACCCMTAAiTCCGATAGTACGGTTACAGAGCGGAGCGGGGCAACGGCAATCAGCTTGATTGAGGTGAGGGACATCAGCCCGCCAGGCGAGCAGGC S L W R P Y E T L N P I V R L Q M L E A A A T A I S L I E V R D I SP P G E Q A FIG. 2 120 240 rt tniA 360 2 480 42 600 82 720 122 840 162 960 202 1080 242 1200 282 1320 322 1440 362 1560 402 1680 442 1800 482 1920 522 2040 559/1 2160 41 2280 81 2400 121 2520 161 2640 201 2760 241 2880 281 3000 302 20 3120 60 3240 100 3360 140 3480 180 3600 220 3720 260 3840 300 3260 RADSTROM ET AL. T D T P R GAAGCGGCC6ATATG E A A D M GGAGGTAAAGGTAAG G G K G K CAGGTGTGCAAGGCT O V C K A CTACAAGGTGTGGGCI L Q G V G CCGTACCTOACCCTC( P Y L T L CGCCCTTGGCTGGAAC R P W L E CAGCATGGCATCCGG Q H G I R TCCAACCCTGACCAG( S N P D Q rCTIGCCTIGA7GAGGCTTGGGAGCGTGMCGCCGTCGIC,CGGAGATCATCAGTCCGTTCvGCGCAGICGGAGACGGTCGGGCACGGAACCC'C'ACGGA 3(3GXccrcre;G- INNGXVazr-G i1(cc:AXU36'G AX,1T:A-G'G4 N'GWI13.6LG XIGkc.C.I3(&;cl r,ITITXM;C( I I o n Septem ber 28, 2017 by guest http://jb.asm.org/ D ow nloaded from TRANSPOSON TN5090 OF PLASMID R751 3261 AAAGCTATTsTGGTCCGAGCCCCAAACCGGGTTCACCAGTG,GCCTGCCGACGAAAGCGCCGAAGCCCGAGCCCATCAATCACTG.GCAGCGTGCAGTCCAGGCCATCGACGAGGCCATCAT K L F W S E P Q T G F T S G L P T K A P K P E P I N H W Q R A V Q A I D E A IXI TG,AAGCGCGA~CACAACCCCGAGACGG;CACGCTCGCTGTTC&GCTGGCTrCCTATGGTCGGCGCGATCCCGCTTCCTT,GGAACGG7nSCGCGCCACCTTCGTGAAGGAAGGCATCCCGCC E A R H N P E T A R S L F A L A S Y G R R D P A S L E R L R A T F V K E G FP P stop orf6 -I1 GGAATTTCTGTCACATTACCTGCCTIGATGCACCCTTTGCATCAAAAATG ACCC GTTAAGTGACAAATTIa &GATAGAGCTTCGGCTJIATCACATAATCGAACG E F L S H Y L P D A P F A C L K Q N D G L S D K F *_35 p -10 AccI start tniC - BamHlI TATACGTGACG9QTAAAAGGTGCTGATCGGCTACATGCGCGTATCGAAGGCGGACGGATCCCAGTCCACCAATTT,GCAACGCGATG.CGCTCATCGCCGCT-GGTGTGAGCCTTGCGCACC RBS M L I G Y H R V S K A D G S Q S T N L Q R D A L I A A G V S L A H TTTACGAGGATCT,GGCCTCGGGAGGCGCGATGATCGCCCAGGGTTG,GCTG,CTTGCCTGAAGGCGCTTCGTGAAGGGGACACGCT,GATCGTGTGGAAGCTCGATCGGC7'GCGTGATC L Y E D L A S G R R D D R P G L A A C L K A L R E G D T L I V W K L D R L G R D Dra&II .SA1I . HizidIII TGCGCCACCTGATCAACACCGTGCACGACCTAACTGCGCGTAGCGISGGCICMAGGTCCTGACCGGTCACGGTGCGGCGGTCGACACGACGACTGCCGCCGGCAAGCTTGT,GTT4CGGTA L R H L I N T V H D L T A R S V G L K V L T G H G A A V D T T T A A G K L V F G TTTTT,GCCGGCGCTGGCCGATTCGAGCGTG6AGTTG.ATTTCCGAGCGAACAGCGG CCCTTCAAGATGACCGCCGCCA I F A A L A E F E R E L I S E R T V A G L I S A R A R G R K G G R P F K M T A A AGCTACGCCTGv.GCGAT,GGC'CAGCATGGGGCAACCGGAAACCAAGGTGGGCGATCTCTCAGACGATCCGAAGTTCGCCTTGCAGGGATC K L R L A M A S M G Q P E T K V G D L C E E L G I T R Q T L Y R H V S P K G E L . stop tniC -.I Sall GGCCAGACGGCGTAAAGCT,GCTCTCCCTCGGTrCAGCCGCATAAATGGAGGCGACCTGGAACGGGGCGCTGTTCAGTGCGGCAACGATCCGATTACCGGT,GTCGACCCAGAGCAGCCGTA R P D G V K L L S L G S A A GAGCTTTTGG;GAAAGCTGTCGTTCAACGCCGAGTTCAGCGGCAGTTTTAAGTTGTGATTTTATCCAATACTTTTGCGCAGCAAAACCATAAAGCCGCGACTTAAAAACTGTCCAGCGCA SS* [F-stop qacE 5 GGAGATCGACG3mACATGTGTATATTTATGGCACG3AGAAGTTAACTCAACACTAACTATGAGCCCCATACCTA HindIII CAAAGCCCCACGCATC.AAGCTTTTGCCCATG,AAGCAACCAGGCAATGGCT ATAAGCGCCGAGTCCCGACGACCTCCGCATACAACACGAGATCGAC HindlIl GAGAAAGAAAATAAAATGCGATGCCATAACCGTAGCACGGAGGCAAGCTTAGTAAAGCCCTCGCTAGATTTTAATGCGGATGTTGCGATTACTTCGCCAACTATTGCGA start qacE +- TAACAAGAAAAAGCCAGCCTTTrCATGATATATCTCCCAATTT,GTGTAGGGCTTATTATGCAC CAGAGCTGACTATAGTTTGGCTGTGAGCAATTATGTGC stop orfD |4-88 TTAGTGCATCTAACGGGCGAGGTAAGCCGACCGCAGAATGCGGGTCGGCTT'GACCGAAAT,GTTAGAGCCAGAAGCCAAAACGGATAACCGTAACTTGC,GACGGGCGCTAACTGCGAAAA ... GGCACGGT,GCCACCGAGGCGGCACAGCACTACGAAAATGC CCGCGC7rCCTACACAAGGGCCAGAGGCCAAAAAGACCACAAACCAGCGTAACGCCACCAGGCGAAG;CCCAGA * start orfD . S*3 GAAACGGCAAACCCAGCGCTGCACAGCGTTTGAGAAACTGAATGCCGTTATACTGCAAAAGGG% ACGTACCGGGGC GCC EcoRI .1| - stop dhfrllc GTCCGCTGGAGCGACCAGl GTTGCGATCCGTTACCGGGTCCCACTGAATTCAGGCCACGCGTTCAAGCGCAGCCACAGGATAAATCTGTACTG AACCGGGGTGAGACTCGGACTCGACGGCATAGCCTTCAGGGGTCAGTTTTGTGCAGTACCACCCGACAACTT,GACCCTGCCAAGCGGCGCCAGATrCI,CCACGCGAT,CTCCCAGGC start dbfrllc 4- CAAACGTGGCGTGCGATGGGAGCGCAAACT,GGCCAGCAACTAGAGTACT,GACTCCATTGTT,GTGTT,GGTCCATATCT,GACCmcrTrETT,GAATiTi-v-T-GAGATcTCAcCA . **2 CGCTGCGTCGGT,GAAGCCCAACTTTGTTTTAGGGCGACTGCCCTGCTGCGTAACATCGTTGCT,GCTCCATAACATCAAACATCGACCCACGGCGTAACGCGCTrGCTTGGATGCCCG -35 p_> * start int AGGCATAGACTGTACAAAAAAACAGTCATAACAAGCCATGAAAACCGCCACT GCGCCGTTACCACCGCTGCGTTCGGTCAGTC,GCCAGTTGCGTGAGCGCATACGCTACTTGCA -10 EK T A T A P L P P L R S V K V L D Q L R E R I R Y L H <-P -10 -35 TTACAGrTTTCGAACCGAACAGGCTTATGTCAACTGGGTTCGTGCCTTCATCCGTTTCCACGGTGTGCGTCACCCGGCAACC'GGGCAGACGATCGAGGCATTTCTGTCCTGGCT Y S L R T E Q A Y V N W V R A F I R F H G V R H P A T L G S S E V E A F L S W L GGCGAACGAGCGCAAGGTTTCGGTCTCCACGCATCGTCAGGCATTGGCGGCCTGTTCTTCGAGGGTTCCGTTCCTGGCTTCAGGAGATCGGAAGACCTCG A N E R K V S V S T H R Q A L A A L L F F Y G K V L C T D L P W L Q E I G R P R *. -. SphI GCCGTCGCGGCGCTTGCCGGTGGTGCT,GACCCCGGATGAAGT,GGTTCGCATCCTCGGrr'GGAGCAGCATCGTTTTTGCC P S R R L P V V L T P D E V V R I L G F L E G E H R L F A Q L L Y G T G E R I S E G L Q L R V K D L D F D H G T I I V R E G K G S K D R A L M L P E S L A P S L PvuIIGCGCGAGCAGCTIGTCGCGTGCACGGGCATGGTGGCTGAAGGACCAGGCCG6AGGGCCGCAGCGGCGTT'GCGCTTCCCGACG~CCCTTGAGCGGAAGTATCCGCGCGCCGGGCATTCCTGGCC R E Q L S R A R A W W L K D Q A E G R S G V A L P D A L E R K Y P R A G H S W P GTGGTTCTGGGTTTTTGCGCAGCACACGCATTCGACCGATCCACGGAGCGGTGTCGTIGCGTCGCCATCACATGTATGACCAGACCTTTCAGCGCGCCTTCAAACGTGCCGTAGAACAAGC W F W V F A Q H T H S T D P R S G V V R R H H M Y D Q T F Q R A F K R A V E Q A AGGCATCACGAAGCCCGCCACACCGCACACCCTCCGCCACTCGTTCGCGACGGCCTTGCTCCGCAGCGGTTACGACATTCGAACCGTG,CAGGATCTGCTCGGCCATTCCGACGTCTCTAC G I T K P A T P H T L R H S F A T A L L R S G Y D I R T V Q D L L G H S D V S T stop int -fl GAGTGTTCCCATG7:CTGAAAGTTGGCGGT ,GCCGGAG7:CGCTCCCGCTTGGAqnCGCT,GCCGCCCCTCACTAGTIGAGAGGTAGGGCAGCGCAAGTCAATCCTGGCGGATTCA f i4 . 1 i3 ~ BaHI CTACCCCTGCGCGAA,GGCCATCGGTGCCGCATCGAACGGCCGGTTGCGGAAAGTCCTCCCTGCGTCCGCTIGATGGCCGGCAGCAGCCCGTCGTTGCTGATGGATCCAACCCCTCCGCT,G CTATAGTGCAGTCGGCTTCTGACG _C_TA_GCCCTGCACAACCAGGCGCAGGCGNTGACCTACTCG CGCGGCTCGGGGGTAGT ( IRi-~~ ~ ~ ~ ~ ~ 8.. TCATCCACAGCCGTTCGATAGCGATGCCGCCGCGCGTCATCGCGTTGAAGTCGATGGTTCTCATGACGCCAAGGGAGAGCTGTCATAGATCGTTGAGCTGTAGCCCGACACCATCACCG CGCACGGCAA,GCCGGCCAGACG 3960 340 4080 380 4200 405 4320 33 4440 73 4560 113 4680 133 4800 193 4920 207 5040 5160 5280 5400 5520 5640 5760 5880 6000 6120 6240 6360 28 6600 68 6720 108 6840 148 6960 188 7080 228 7200 268 7320 308 7440 7560 7680 7800 7827 FIG. 2. The nucleotide sequence of TnSO9O and its immediate surroundings in plasmid R751. Arrows indicate IRs; those of 25 bp at the limits of Tn5O90 are denoted IRt and IRi, and those of 19 bp close to the ends are denoted tl to t3 and il to i4. The ORFs tniA, tniB, orf6, and tniC and the previously observed int (42, 57) are shown with their translations. Locations of important branch points that are marked by # and numbered are also shown in Fig. 1. Promoters are indicated by P and an arrow. The borders of cassettes are indicated by vertical arrows (note that cassette genes and ORFs are translated from the opposite strand). The sequence shows two sequences determined previously, i.e., that for the qacE multiresistance gene, which has recently been described in a separate study (45), and a revised version of that for the dhfrIIc gene (17). The integrase gene segment of the R388 integron (from no. 2 to 1; see Fig. 1) was analyzed here and revealed complete identity to Tn5O9O. VOL. 176, 1994 o n Septem ber 28, 2017 by guest http://jb.asm.org/ D ow nloaded from 3262 RADSTROM ET AL. A 1.4 0.7 0.4 2.3 C 2.7 B w~ I _- l _ _ IRi int dhfrVII qacEAl sulI tniB 1.4 1 0.6 1 1.9 2.7 I I \~ I I ~~~~~~~~~~~~A aadAl 4.2 0.9 tniAIRt 5%~N Tn5090 IRt (R751) Tn5 093 (Tn5O86) Tn5092 (Tn2l) 2 kb B IRL genetic cassettes | inC dhfrI aadAl tnsE tnsD t1i nsA sat Tn7 2 kb FIG. 3. Physical organization of TnSO9O and two related elements and similarities with Tn7. (A) Genes and conserved areas (hatched) among Tn5O9O, Tn5O92, and TnSO93. ORFs are indicated by horizontal arrows, and those located on cassettes are marked with open arrowheads. Small figures indicate the sizes in kilobases of the constant and variable segments. A, B, and C at the vertical arrows refer to the sections of Fig. 6 where sequences at breakpoints are given. RS indicates the cassette insertion site 5' of int. (B) Map ofTn7 based on references 18, 32, and 58 and citations therein, shown for comparison. Names of structures or putative functions in Tn7 corresponding to features of TnSO9O are boxed. Filled vertical boxes indicate terminal repeats. All three transposases carried the motif D,D(35)E earlier observed in the latter protein and in a newly defined super- family of bacterial transposases and IN proteins of long terminal repeat retroelements and retrotransposons (16, 31, 49). Less certain similarity (18% identity) was observed with transposase (A) of phage Mu (26), which seemed to contain only the first D (D-269) and the E (E-392) of the complete D,D(35)E. Those transposases of IS elements which carry the D,D(35)E motif (16) had less similarity to the tniA gene product than the level of similarity among TniA, TnsB, and P480. The second ORF predicted to take part in transposition, tniB, is located between tniA and orf6 and in the same orientation. It encodes a 302-amino-acid polypeptide which was predicted to be isoelectric at neutral pH. This contrasts with the basic products encoded by int, tniA, and tniC (see below). The amino acid sequence of the tniB gene product indicated two sites for potential binding and hydrolysis of nucleoside triphosphates (22) (Fig. 5) and showed 21% iden- tity to the TnsC protein of Tn7 (18) and 24% identity to the B protein of bacteriophage Mu (37). Both TnsC and MuB are ATP-binding proteins (20, 36), and p271 of TnSS2 is also very likely to be one (49). The ORF tniC codes for a recombination protein of a type different from those encoded by int, tniA, and tniB and was found in the unique 2.3-kb region of Tn5O90. The putative promoter was observed in the region between orf6 and tniC, and the latter gene may thus have its own regulation separate from the operon of tniA, tniB, and orf6. The product of tniC consists of 207 amino acids when the most probable translation start (GTG) is utilized. With its 67% identity to the resolvase of TnS393 (10) and 47% identity to Gin of phage Mu (46), it belongs to the invertase/resolvase family of site-specific recom- binases (Fig. 5) (21). The identity to most transposon re- A 4, J. BACTERIOL. o n Septem ber 28, 2017 by guest http://jb.asm.org/ D ow nloaded from TRANSPOSON TNSO90 OF PLASMID R751 3263 int dhfr orfD qacE tniC orff6 tniB tniA 0.00 7.58 3.43 8.71 4.58 3.63 2.02 0.81 0.00 5.89 6.98 6.92 3.87 6.81 6.72 0.00 8.58 5.92 5.06 4.60 3.10 0.00 9.12 8.13 9.72 9.70 0.00 4.97 2.74 3.48 0.00 2.47 3.79 FIG. 4. Correspondence analysis of codoi usage was analyzed by the Genetics Comput RESPOND (14) using the statistics describes The tniB gene was truncated to include o Tn5O9O, Tn5092 and TnSO93. D-squared v likelihood of a common origin for the genes solvases, e.g., that of Tn21 (24), was lo, most conserved residues of invertases/rc including the serine 9 corresponding Ser-9 in Gin (30). There was also a binding motif (43) close to the 3' end. Tn5O9O ends have a complex structui at the 25-bp terminal IRs of TnSO9O bc This characteristic of ends has been obs IS elements (16, 19), transposons Mu, after end processing, also for retrovi posons. Beginning eight nucleotides i there were 19-bp repeated sequences th at the left end (il, i2, i3, and i4) and thre (tl, t2, and t3) (Fig. 7). The repeats i3 a most diverged from the others (see cons 7B). The repeats at one end were in ti with respect to those occurring at the o the t2 repeat at the right end. Similarly ( to the ends of both bacteriophage M identified as the binding sites for the r MuA and TnsB (1, 13). Further sequences external to IR, a pLMO20 (classified here; see Material an integron (57) which was found he element flanked by both IR, and IR. nucleotide sequencing and was found stream of the unique SacI site close tc inverted repeats, IRt and IRE, in pLMO, direct repeats (CTGTT; see Fig. 6A ai probably a target site duplication. The however, lacked the transposition genm ably as a result of the presence of an IS observed to be joined to an EcoRII re gene, as shown previously for IncN elements carry the IS6100 (33) 152 bp We sequenced the IRi borders of containing elements. These elements ii revealed unique border sequences (Fig IR; border sequence was documented I Some TnSO9O-like elements have persist location. One example is IncW plasmid to be flanked outside IRi by the same se4 sequences flanking Tn5092 and TnS5U (Fig. 6). Nevertheless, we have shown a variety of other sequence contexts harboring Tn5O90-related elements, which warrants their identification as a family of transposable ele- int ments flanked by 25-bp IRs. TnSO9O probably represents a dhfr complete version of these transposons, while other elements, e.g., that in R388, have lost major parts in the course of orfD plasmid evolution (Fig. 1 and 6). qacE tniC orf6 DISCUSSION In this work, a type of elements carrying integrons is 0.00 1.27 tniB identified as potential transposons related primarily to a few 0.00 tniA other mobile elements in bacteria and also remotely to the retroelements. By detailed study of a range of plasmids of usagerinpTn0o9. Codon different incompatibility groups (e.g., W, P, N, and F), wedrb Groutphrogram Rl.(3). confirm here that the 25-bp IRs IRi and IR, are the true endsInby Granthampat al.mon(. of this family of elements.nly the part common to A distinguishing feature of the retroviral type of mobile elements is the dinucleotide 5'-TG which always occurs at their termini (31, 63). The ends of Tn509O as well as the ends of Tn7 (32), of Mu (28), and of Tn552 (49) carry 5'-TG, which is also found at the ends of most IS elements coding for a transposase wer, around 30%. The of the retroviral superfamily (16, 19). The 5'-TG ends of esolvases were present, retroviruses and retrotransposons are exposed only after the to the DNA-reactive removal of one or two terminal nucleotides (38, 63). The ends helix-turn-helix DNA- of both Mu and Tn7 have an unusually complex structure with several iterations of the target sequence for binding of trans- re. The conserved ends posase (1, 11, 32). These repeated sequences in Mu were egin by 5'-TG (Fig. 6). recently shown to take part in assembly of the active tetrameric served earlier for some form of the transposase MuA (4). This assembly process was TnSS2, and Tn7, and, described as a key regulatory step in Mu transposition. We iruses and retrotrans- have observed here similar 19-bp repeats close to the ends of nward from each end Tn5090 which could indicate a relationship between the trans- iat occurred four times position mechanisms of these transposable elements. This e times at the right end would also mean that the transposase of Tn5090 is a multi- ind i4 seemed to be the meric protein which requires the 19-bp repeats near each end ,ensus sequences in Fig. in order to assemble (3, 15). he inverted orientation Recently, the Xanthomonas mercury resistance transposon Ipposite end, except for Tn5053 (29) was reported to carry IRs of 25 bp similar but not organized repeats close fully identical to those of TnS092 (the 11-kb element in Tn21 ,u and Tn7 have been [7])and to generate 5-bp direct repeats of the target sequence. espective transposases, Both Tn5092 and the integron-containing element of pLMO20 (Fig. 6) are bracketed by 5-bp target duplications. The absence and IRt. IncN plasmid of target duplications around Tn5090 could be due to an s and Methods) carries adjacent deletion removing the bordering segment on one side. re to be borne on an The available sequence for the right end of TnSO53 (722 bases) . IRt was localized by is 79% identical to the right end of TnSO9O and contains the to occur 1.8 kb down- three 19-bp repeats (tl, t2, and t3; Fig. 7) and the 5' part of a ) sulI (57). Both 25-bp tniA-like (81%-amino-acid-identity) gene. 20 were flanked by 5-bp It has been shown that retroviral integration mechanistically nd B); this sequence is resembles the transposition of bacterial mobile elements (38). element of pLMO20, The recent finding (16, 49) of a structural similarity among the es of Tn5090, presum- probable transposase P480 of TnSS2, some IS transposases, ,6100 (25). The IRt was and the retroviral transposases, commonly called integrases or striction endonuclease IN proteins, supports this view. The D,D(35)E motif in the plasmid N3 (6). Both active regions of all of these transposases is highly conserved from the end of IRt. (38). The motif also includes a few additional amino acids of a few more integron- more relaxed conservation. Some of these are aspartic acid n R388 and pLMO229 residues. There is proof obtained by mutagenesis that the two 6A). Another unique aspartic acid residues and the glutamate of D,D(35)E in IN previously in R46 (56). proteins are critical both for cytoplasmic end processing of the ted in the same plasmid reversely replicated viral genomes and for their subsequent I pSa, which was found insertion into a host chromosome (31). The related bacterial quence as in R388. The transposases await similar analysis. The interactions between 93 were also identical the three acidic amino acids and DNA may be similar to those VOL. 176, 1994 V. VV o n Septem ber 28, 2017 by guest http://jb.asm.org/ D ow nloaded from MSMATDT ... PRIPEQGVATLPDEAWZRARRR.AEIISPLAQSET .V 40 MWQINEVVLFDNDPYRILAIEDGQVVWMQI SADKGVPQARAELLLMQYLDEGRLVRTDDPYVHLDLEZPSVDSV8FFQR=DYIKLPXXNSKDRFDPKV 10 0 MKNKZKYLTNFSEAZRKE&TQK.YNISKPF....I L 31 GHAADMAAQALGLSRRQVYVLIRRARQGSGLVTDLVPGQSGG .....................GKG. RLPEPVERVIBHLLQRMFLTKQKR. SL&AF 117 RSZLVEHVVQEHXVTKATr6RYWQRaQT PNALXPDYKNSGAPGERRSATGTAKI GRAREYOT=TVPEIMILFRLTIEKLNQKGTKTTJY 20 0 .KQSLSSISKSKGIALSTLYRWNKLYKEQG. .LTGLIH.NTRV...... .QNIXDZI..KLALKNKRNBIATI 101 EVTQVC ..... KAQKLRVPARNTVALRIASLDPRKVIRRR. EGQDAARDLQGV. GGEPPAVTAPLXQVQXDNTVIDLIVVDDRDRQP. IGRPYLTLAI 209 RR}tVDLFAQYFPRXPQEDYPTLRQFRYFYDREYPKAQRLKSRVKAGVYKKDVRPLSSTATSQALGPGSRYEX1_ATIADXYLVDHHDRQKIIXlRPTLYXVI 30 0 HRKIANYC..... IENNFYKPSYKQVYSIIKAMPKSVIDFSH. QGEKYQNKYDL ..IQIRESSRPN3IWQA2HTLLDIYILDQKGN... INRPWLTIIM 190 IS3 .. .GPNQKWAGDITYLRT... Copia .. .RPLFVHS2VCGPIT... MoMLV ... RPGTHWEIDFTEVKP... D DVVTRCVLGMVVTLZAPSAVSVGLCLVHVACDKRPWLEGLNVM ... DWQMSGKPLLLYLINAAZFKBEALRRGCEQHGIRLDYRPLAQPHYGGIVXRIII 306 DVFSRMITGFYXGVNNPBYVVAMQAFVNACSDKTAICAQHDIZISSSmPCVGLPDVLLA2RG. ZLM8HQVZALVSSFNVRVESAPPRRGDAKGIV5STF 399 DDYSRAIAGYFISFDAPNAQNTALTLHQAIWNKN ........ NT...NWPVCQIPEKFYTPSHGSDYrTSHMZQVAIDLKINLMFSKVGVPRGRGKI5RFF 279 IS3 Copia MoMLV ... IVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCCYDNACV5SFFH ... YLYIDNGRXYLBNEMRQFCVKKGISYHLTVPHTPQLNOVSZMIR ... ... VLGTPNGPAFVSQVSQSVAKLLGIDWKLHCAYRPQSSGQVIRMR... D E TniA GTAMQMIHDELPGTTFSMPDQR ......... GDYDSENKAALTLRELZRWLT LAVGTYHGSVH ..NGLLQPPAARWAEAVARVGVPAVVTRATSFLVDF TnsB RTLQAE KSFAPGIVEGSRIKsHGETDYRLDASLSVFEFTQI ILRTILFRNNHVMKYDDAPDLPsIPVQLWQWGMQHRTGSLRAVEQEQLRAL P480 QTVNQTFLEQLPG.YINNNDTs ......... SDL IDFQNFFEKLRYFLIEDYNQKEH. .SAIQSTPINRWNSNHFFPNMPSSLEQLDLLLLEI TniA LPILRRTLTRTGFVIDHIHYYADALKPWIARRYERWPSFLXRRDPRDISRIWV.EPEGQHYLEIPYRTLSHPAVTLWQR..................... TnsB LPRRKVSISSFQVNLWGLYYsGSEI. LREGWLQRSTDIARPQHLEAAYDPVLVDTIYLFPQVGSRVFWRCNLTERSRQFKGLSFWEVWDIQAQEKHNKA P480 PK. .SRKXHsDGIHFQGFRYsNTNLTAYVG EYVLIRYNPNDtNAEIRVFYRDEFLCTAIS. PDLADYSIDIKEIQ TniA TnsB P480 394 499 360 473 597 431 .QALALRQQGREQVDE8ALFRMIGQMREVT8AQKATRIA3RDADRRQHLKTSARPDKPVPPDTDIADPQADNLPPAKPFDQIEEW- 559 NAKQDELTKRRELEAFIQQTIQKANKLTPSTTEPKSTRISQXKTNKRAVTSERKKRAEHLKPSSGDEA4VI0PFNAVEADDQEDYSLPTYVPELFQDPPEKDES- ........^SQIRRKHLKQNIASPSSZTDLXIREEXSYGY8PQZTTKnU YRND* 48 0 B Tn5090 TniB MDEYPIIDLSHLLPA ..........................AQGLARLPAD ............ Z.RIQRLRADRWIQ. YPRAV Tn7 TnsC MSATRIQAVYRDTGVEAYRDNPFXEALPPLQESVNSAASLKSSLQLTSSDLQKSRVIRAHTICRIPDDYFQPLGTHLLLs .RXsvMIRGGYVGR -KTG Mu B MNISDIRAGLRTLVENEETTFKQIALESGLSTGTXSSFXNDKYNGDEERVS TniB EARLELYAWPNKQRM...................PNLVTN SMIVEKFRRTHPAS SDADQZHIPVLWQMPSEPSVIRFYVAL TnsC DLQKHLQNGYERVQTGELETFRF3EARSTA Q LLIgCTSaSRLHRILATAYQVIYHRELNVFQVVYLKIDCSHNGSLKEICLNF B QMLQRWLEKY.AVAELPEPPRFV3TQTVKQIWTSMRFASLTESIAVVCffl4. ....AAREYRRTM MITITPSCAV LC. NTP-motif 1 TniB TnsC B LAAMGAPL RPRPRLPEMEQLALALLRKV... GV}RZDYZLHNVLRGN8VNRRZFLELLRFLGUELRIPLVGVGTRD&YLAIRSDDQLENR... FRALDRAI4SNYERRYGLKRHGIETNI LSSQIANAHALGL GZZIQHLSRSRBGGSQZMLFFVTMVNIIGVPVMLIGTPKAREIFEADLRSARRGAG LTELAFELGM DAPRRKGPLSRALRRRLEGTQG. LVIIDZADLG& ZVLEELRLLQESTRIGLVLMQNHRVYSNMTGGNRTVEFARL NTP motif 2 TniB FEPMMLPVWE .ANDDCCSLLASFAASLPLRRPSPIATLDMARYLLTRSEGTIGELA.LAALIVAVESGZZAINH ...............RTLSM TnsC JGAXFWDPIQQTQRGKPNQEWIATDNLWQLQLL.QRKDALLSDEVRDVWYELSQVDVKFLQRAAMITAGLLRQVYQDELKPVHPMLE B FSRI AKRTAINKTKKADVKLIADAW.. QINGEKELELLGQQ IAQKPGALRILNHSLRLAAMTAHGKGaRVNEDYLRQAFRELDLDVDISTLL Tn5O92 TniB AC* 286 Tn5093 TniB ACRQPLAQPRHRGRTASDLZATGPSHPDMDLDRRTDVRFRVLGVRL* 330 Tn5O9O TniB AVYTOPS3RRRQFERELM- 302 TnsC ALRSGIPZRIARYSDLVVPZIDKRLIQLQLDIAAIQEQTPEEKALQELDTEDQ... 440 B RN* 312 C Tn5O9O TniC Tn5393 TnpR Mu Gin TniC TnpR Gin M.XGzMaDVRaBG8Q8PNLQ3DALIAAaVSLAHLY3DL&8GRRDDRPGLALCLRAL3EQDTLIVWKLDRIaRDLRLXTVHDLTARsVGLKVLT? S HGaAVDATTTAGKLVGXA SZaRITLVAGMIBARAMGZEQRPOM4TAAK PQPETKVGDLCEZaXTRQTLYRHVSPKOZLRPD KOAQI LDAtSItXATLAFRLARDI _V14DTV LCKI LaERVTLYYVGPOULDH .SI.. DTSSPMGtFFVHMGALaZMzRNLXIRGLRN--PKLWRIGQPPKLTHAEWEQAGRLL&Q. GIPRKQVALIYDVALSTLYKKHPAKRAHIEN * . . --- . *...- --..- **-**-** *- ** ***---*--* .. . ... .. . .... . .. .. I-.---- .------- Ihelix helix TniC GVKLLSLGSAA* 207 TnpR OKHVLGLT* 204 Gin DDRIN* 193 702 43 98 51 116 187 135 204 287 221 284 387 310 96 96 92 196 196 188 3264 RADSTROM ET AL. A J. BACTERIOL. Tn5O90 TniA Tn7 TnsB Tn552 P480 TniA TnsB P480 TniA TnsB P480 TniA TnsB P480 o n Septem ber 28, 2017 by guest http://jb.asm.org/ D ow nloaded from TRANSPOSON TN5090 OF PLASMID R751 3265 FIG. 5. The amino acid sequences of the translated ORFs tniA, tniB, and tniC of Tn5O9O (see Fig. 2 and 3) aligned with those of recombination proteins studied earlier. Amino acids identical in at least two of three polypeptides are indicated by boldface letters. Amino acids identities between Tn5O9O and an aligned sequence are marked with small dots, and identities with both sequences are marked with larger dots. (A) The product of tniA aligned with the transposases TnsB from Tn7 (1, 18) and P480 from Tn552 (49). The alignment of the conserved D,D(35)E motif (31, 49) of the retroelement integrase superfamily includes short segments of the transposases/IN proteins of IS3, Copia, and Moloney murine leukemia virus (16, 49). (B) The protein encoded by tniB aligned with the ATP-binding proteins TnsC of transposon Tn7 (18) and B of bacteriophage Mu (37). The sites potentially binding nucleoside triphosphates (22) are underlined. A vertical arrow marks the sequence divergence corresponding to the end of the 2.7-kb segment. (C) Comparison of the probable resolvase encoded by tniC in R751 with the resolvase TnpR of transposonTn5393 (10) and the invertase Gin of bacteriophage Mu (46). The catalytic serine 9 of Gin (30) and the helix-turn-helix motif for DNA binding (43) are marked. between the E. coli DNA polymerase I and DNA involving the binding of a metal ion (40). The gene tniA codes for the probable transposase of TnSO9O, which was observed to contain the D,D(35)E motif. The tniA gene product is related to the transposases of Tn552 and Tn7 not only by this motif but also by a fairly high amino acid similarity for other parts of the polypeptides. The D,D(35)E regions among these related transposases appear to be as closely related to the IN proteins of retroelements (31) as to the IS element transposases (e.g., that of IS3 [16]) carrying the motif. Some similarity was also observed with MuA trans- posase, which may carry an incomplete D,D(35)E motif. If the other aspects of similarity with Tn7 and Tn5O9O are consid- ered, it seems plausible that Mu could have a related trans- posase. The tniB gene codes for a protein with the sequence motifs GPTNNGKS and MLVIDE (Fig. SB), which indicate a site for binding of nucleoside triphosphates (22). Transposons Tn7 (TnsC) and bacteriophage Mu (B) encode separate proteins which make use of ATP for transpositional recombination (18, 20, 37). A gene for a potential ATP-binding protein, P271, has also been described for TnSS2 (49). The genes for transposase and ATP-binding protein in the three mentioned transposons are consecutive and located close together, which indicates a possibility of translational cooperativity for expression. The product of tniB is weakly related to both TnsC (21% identity) of Tn7 and to the B protein (24% identity) of Mu. MuB increases the efficiency of Mu transposition and affects the choice of target sites (35). It may belong to the proteins named molecular matchmakers which are supposed to utilize ATP for the creation of transient conformational changes in proteins or DNA (51) which could temporarily make possible critical A pLMO20 Tn2l /Tn5O86 R751 pLMO229 R388/pSa pLMO20/N3 IS6100 Tn2l/Tn5O86 tniA <- R751 tniA <- R388 Tn2l Tn5O86 Tn2l R751 sulI -> sulI -> sulI -> 4.2 kb tniC <- <- int <- int <- int <- int <- int -> ecoRII <- mer 4.2 kb <- tniB <- tniB <- tniB GG TTCCCGGTTCAAA TGCACTGAACG AGAGAATGAGGAACACCAGA TGTCGTC&G&GCGGCC&CTG&&CG -IRj - ) B DR CAACTGGTC>WCQCTTCTG&AA&TGAC& CGIrTTGTATATAATCATGA CAACTGGTGCAGTCGTCTTCTGAAAATGACA TCCATGCCCAGCCCGTGCGC CACTGGTGCAGTCGTCTTCTGAAAATGACA TCTTGGCCGGGTCGTTATTG IRt ( ti C ATGTCTTGGTTGCGC G&Q>TGCGATATCCTCCACTTCCATCATCAAC ATGTCS O G G&TATCTGTTGATTTGCACCCAAAT CAOTGGGTCAATTTTAGATGCAACTCAACAGCACATCGCSOOTGTGCGATG FIG. 6. Nucleotide sequences at branch points of the integron-carrying elements in R751, Tn5O86, Tn2l (7), pLMO20, N3 (6), pLMO229, R388, and pSa (see Fig. 1 and 3). The locations of A, B, and C are marked in Fig. 3. Note that the sequences are given for the opposite strand with reference to Fig. 2. (A and B) Branch points at the left and right ends, respectively, of R751, Tn2l, and pLMO20 are indicated. Bases which belong to the integron-carrying elements are indicated by boldface letters, and 5-bp direct repeats of the target sequences are underlined. An insertion of IS6 (19) in pLMO20 with an associated 8-bp target site repeat (CTGCACTG) is indicated. (C) Coinciding branch points; the sequence at the transition between the 2.7- and 2.3-kb segments in Tn5O9O (see Fig. 1, 2, and 3) and those at the junction between the 2.7- and 1.9-kb segments in Tn5O93 which contains a 4.2-kb insertion in TnSO92 (60) and marks the rightmost (Fig. 1) end of homology with R388. Boldface letters indicate identity in at least three sequences. DR rIS26 TAACAGCCTTTCTGGCTGTT TGTCGTTTCAQ G QG C&CTG&&C tnpR <- CCCTCGGCTACCACCTCATTGTGTTC3AG&&GACGCTGCACQACGQ GCGCCCATACGCGCTTGACC TGTCGTTTTC&GAAGACCTGCACAACG VOL. 176, 1994 o n Septem ber 28, 2017 by guest http://jb.asm.org/ D ow nloaded from 3266 RADSTROM ET AL. A L Tn5O9O R L Tn7 R L Mu R -- -70 -moil ±2 ±3 ±4 t'12 t-3M -- ->A L1 L2 L3 -I - Rlb > R3 mRw. R2I Li L2 L3 RI 2Ri 32 R33 B TCAGAAGACGGCTGCACTG TCAGAAGCCGACTGCACTA TCAGAAGACGACTGCACCA TCAGGAGCTGGCTGCACAA TCAGAAGTGATCTGCACCA TCAGRAGncRrCTGCACyR <- 10 bp TCAGGCAACGACGGGCTGC TCAGCGGACGCAGGGAGGA TCAGRRGncGrCtGcAcnR ii i2 tl t2 t3 il-2, tl-3 i3 i4 all FIG. 7. The multiple repeats of 19 bp which are clustered at the ends of Tn5O9O, Tn5O92, and Tn5O93 and of the corresponding element in pLMO20. (A) Organization of multiple repeats at the left (L) and right (R) ends of Tn5O9O and of the 22-bp repeats similarly occurring near the ends of Tn7 (1, 32) and Mu (4, 13, 28). Transposon sequences are marked by a straight line, and surroundings are indi- cated by a zigzag line. (B) The nucleotide sequences of the seven copies of the 19-bp repeats of Tn5O9O. Consensus sequences are given in boldface letters. The two most conserved parts of the repeats are separated by about 10 bp, as indicated, which corresponds to one helical turn of DNA. macromolecular interactions. The direct contact between an activated molecule of MuB and Mu transposase stimulates DNA strand transfer; however, ATP hydrolysis does not appear to be essential (5, 61). A similar function of the product of tniB could be expected. Few transposons are known to carry a separate gene for an ATP-binding protein, supporting the idea that TnSO9O is related to Tn7, Mu, and Tn552. The tniB gene starts only two nucleotides downstream of tniA and thus reads in the -1 phase (9) with respect to the latter. A small part of the 3' end of tniB in Tn5O9O does not belong to the conserved segment of 2.7 kb, which makes the products of the tniB genes in Tn5O92 and TnSO93 contain different C-terminal amino acid sequences. We observed that orf6 (Fig. 2 and 3) has its most likely translation start codon (GTG) just at the 3' end of tniB in Tn5O9O, in the -1 phase. Starting from this codon, orf6 encodes a neutral polypeptide of 405 amino acids. A probable operon promoter was found between IRt and the start of tniA. This operon includes both tniA and tniB and probably also orf6. The overlap of the promoter with repeat t2 suggests that expression of the operon could be regulated by binding of the tniA gene product to that sequence. The tniC product may be required in a resolution step in transposition of Tn5O90. Its relatively strong similarity to the invertase branch of the family including Gin of Mu (47% [46]), compared with the weaker similarity with most transposon resolvases, such as, e.g., that of Tn2l (about 30%), is unusual. However, recent data show that the structures of resolvases may be sufficiently diverse to also include TniC. The putative resolvase encoded by the recently studied transposon Tn5393 (10) is the protein that most closely resembles TniC (67% amino acid identity). Furthermore, the potential resolvase of Tn552, BinL (49) is 42% identical to TniC and similarly related to Gin of Mu. We have shown here that Tn5O9O, Tn7, and TnS52 carry genes for related transposases, which could indi- cate that donor cleavage and strand transfer occur similarly for these elements. There are no direct data yet available suggest- ing which mechanism is used for TnSO9O and Tn552; however, candidate resolvases in both elements suggest replicative trans- position. The structurally related Tn7 moves by direct trans- position (3), which is notable. It could be mentioned that an interrupted gene identical to tniC but deleted for 408 bp of the central part was found by a computer search 3' of the LCR-1 P-lactamase gene in transposon Tn1412 (12). Our findings show that integrons are located on a new type of transposable elements, although it is still open to specula- tion whetherthe integrons and their carrier elements have evolved in concert. The result of codon usage analysis (23) is consistent with a common origin for tni4, tniB, and int (Fig. 4). tniC and orf6, however, seem to have slightly different codon usage than tniA and tniB (Fig. 4). From a comparative view, it is noteworthy that Tn7, besides being related to Tn5O9O, also seems to contain a similar but distinct variant of the integron integrase and similarly inserted cassettes (57-59). We observed that the Tn7 genes tnsA-E (32) and int have a very similar codon usage, but one that is distinct from that of TnSO9O. This indicates that there may be an old connection between the integrase systems (termed integrons) and their respective transposons. Expression and purification of proteins from the ORFs of Tn5O9O are in progress. The links between Tn5O9O and its transposon and retroelement relatives merit further exploration. ACKNOWLEDGMENTS We thank V. Nikiforov, Russian Academy of Sciences, Moscow, Russia, for mutual communication of data prior to publication; and Birgitta Nilsson, Carl-Gustaf Thulin, and Katarina Erixon for skillful technical assistance. This work was supported by the Swedish Medical Research Council. REFERENCES 1. Arciszewska, L. K., R. L. McKown, and N. L. Craig. 1991. Purification of TnsB, a transposition protein that binds to the ends of Tn7. J. Biol. Chem. 266:21736-21744. 2. Argos, P., A. Landy, K. Abremski, J. B. Egan, E. Haggard- Ljungquist, R. H. Hoess, M. L. Kahn, B. Kalionis, S. V. L. Narayana, S. L. Pierson, N. Sternberg, and J. M. Leong. 1986. The integrase family of site-specific recombinases: regional similarities and global diversity. EMBO J. 5:433-440. 3. Bainton, R., P. Gamas, and N. L. Craig. 1991. Tn7 transposition in vitro proceeds through an excised transposon intermediate gener- ated by staggered breaks in DNA. Cell 65:805-816. 4. Baker, T. A., and K. Mizuuchi. 1992. DNA-promoted assembly of the active tetramer of the Mu transposase. Genes Dev. 6:2221- 2232. 5. Baker, T. A., M. Mizuuchi, and K. Mizuuchi. 1991. MuB protein allosterically activates strand transfer by the transposase of phage Mu. Cell 65:1003-1013. 6. Bhagwat, A. S., B. Johnson, K. Weule, and R. J. Roberts. 1990. Primary sequence of the EcoRII endonuclease and properties of its fusions with ,B-galactosidase. J. Biol. Chem. 265:767-773. 7. Brown, N. L., T. K. Misra, J. N. Winnie, A. Schmidt, M. Seiff, and S. Silver. 1986. The nucleotide sequence of the mercuric resistance J. BAC-FERIOL. o n Septem ber 28, 2017 by guest http://jb.asm.org/ D ow nloaded from TRANSPOSON TN5090 OF PLASMID R751 3267 operons of plasmid R100 and transposon TnS01: further evidence for mer genes which enhance the activity of the mercuric detoxi- fication system. Mol. Gen. Genet. 202:143-151. 8. Cameron, F. H., D. J. Groot Obbink, V. P. Ackerman, and R. M. Hall. 1986. Nucleotide sequence of the AAD(2") aminoglycoside acetyltransferase determinant aadB. Evolutionary relationship of this region with those surrounding aad4 in R538-1 and dhfrII in R388. Nucleic Acids Res. 14:8625-8635. 9. Chandler, M., and 0. Fayet. 1993. Translational frameshifting in the control of transposition in bacteria. Mol. Microbiol. 7:497-503. 10. Chiou, C.-S., and A. L. Jones. 1993. Nucleotide sequence analysis of a transposon (Tn5393) carrying streptomycin resistance genes in Erwinia amylovara and other gram-negative bacteria. J. Bacte- riol. 175:732-740. 11. Collis, C. M., and R. M. Hall. 1992. Site-specific deletion and rearrangement of integron insert genes catalyzed by the DNA integrase. J. Bacteriol. 174:1574-1585. 12. Couture, F., J. Lachapelle, and R C. Levesque. 1992. Phylogeny of LCR-1 and OXA-5 with class A and class D ,B-lactamases. Mol. Microbiol. 6:1693-1705. 13. Craigie, R., M. Mizuuchi, and K. Mizuuchi. 1984. Site-specific recognition of the bacteriophage Mu ends by the Mu A protein. Cell 39:387-394. 14. Devereux, J., P. Haeberli, and 0. Smithies. 1984. A comprehensive set of sequence analysis programs for the VAX. Nucleic Acids Res. 12:387-395. 15. Echols, H. 1990. Nucleoprotein structures initiating DNA replica- tion, transcription and site-specific recombination. J. Biol. Chem. 265:14697-14700. 16. Fayet, O., P. Ramond, P. Polard, M. F. Prere, and M. Chandler. 1990. Functional similarities between retroviruses and the IS3 family of bacterial insertion sequences. Mol. Microbiol. 4:1771- 1777. 17. Flensburg, J., and R Steen. 1986. Nucleotide sequence of the trimethoprim resistant dihydrofolate reductase encoded by R plasmid R751. Nucleic Acids Res. 15:2385. 18. Flores, C. C., M. I. Qadri, and C. P. Lichtenstein. 1990. DNA sequence analysis of five genes, tnsA, tnsB, tnsC, tnsD and tnsE, required for Tn7 transposition. Nucleic Acids Res. 18:901-911. 19. Galas, D. J., and M. Chandler. 1989. Bacterial insertion se- quences, p. 109-165. In D. E. Berg, and M. H. Howe (ed.), Mobile DNA. American Society for Microbiology, Washington, D.C. 20. Gamas, P., and N. L. Craig. 1992. Purification and characteriza- tion of TnsC, a Tn7 transposition protein that binds ATP and DNA. Nucleic Acids Res. 20:2525-2532. 21. Garnier, T., W. Saurin, and S. T. Cole. 1987. Molecular charac- terization of the resolvase gene, res, carried by a multicopy plasmid from Clostridium perfringens: common evolutionary origin for procaryotic site-specific recombinases. Mol. Microbiol. 1:371-376. 22. Gorbalenya, A. E., E. V. Koonin, A. P. Donchenko, and V. M. Blinov. 1988. A conserved NTP-motif in putative helicases. Nature (London) 222:22. 23. Grantham, R., C. Gautier, M. Gouy, M. Jacobzone, and R. Mercier. 1981. Codon catalog usage is a genome strategy modu- lated for gene expressivity. Nucleic Acids Res. 9:r42-r79. 24. Grinsted, J., F. de la Cruz, and R. Schmitt. 1990. The Tn21 subgroup of bacterial transposable elements. Plasmid 24:163-189. 25. Hansson, K., 0. Skold, P. RAdstrom, J. Flensburg, G. Swedberg, and L. Sundstrom. Unpublished data. 26. Harshey, R. M., E. D. Getzoff, D. L. Baldwin, J. L. Miller, and G. Chaconas. 1985. Primary structure of phage Mu transposase: homology to Mu repressor. Proc. Natl. Acad. Sci. USA 82:7676- 7680. 27. Hyde, D. R., and C. D. Tu. 1985. tnpM: a novel regulatory gene that enhances Tn21 transposition and suppresses cointegrate resolu- tion. Cell 42:629-638. 28. Kahmann, R., and D. Kamp. 1979. Nucleotide sequences of the attachment sites of bacteriophage Mu DNA. Nature (London) 280:247-250. 29. Kholodii, G. Y., 0. V. Yurieva, 0. L. Lomovskaya, Z. M. Gorlenko, S. Z. Mindlin, and V. G. Nikiforov. 1993. TnSO53, a mercury resistance transposon with integron's ends. J. Mol. Biol. 230:1103- 1107. 30. Klippel, A., G. Mertens, T. Patschinsky, and R. Kahmann. 1988. The DNA invertase Gin of phage Mu: formation of a covalent complex with DNA via the phosphoserine at amino acid position 9. EMBO J. 7:1229-1237. 31. Kulkosky, J., K. S. Jones, R. A. Katz, J. P. G. Mack, and A. M. Skalka. 1992. Residues critical for retroviral integrative recombi- nation in a region that is highly conserved among retroviralV retrotransposon integrases and bacterial insertion sequence trans- posases. Mol. Cell. Biol. 12:2331-2338. 32. Lichtenstein, C., and S. Brenner. 1981. Site-specific properties of Tn7 transposition into the E. coli chromosome. Mol. Gen. Genet. 183:380-387. 33. Martin, C., J. Timm, J. Rauzier, R Gomez-Lus, J. Davies, and B. Gicquel. 1990. Transposition of an antibiotic resistance element in mycobacteria. Nature (London) 345:739-743. 34. Martinez, E., and F. de la Cruz. 1990. Genetic elements involved in Tn2l site-specific integration, a novel mechanism for the dissemination of antibiotic resistance genes. EMBO J. 9:1275- 1281. 35. Maxwell, A., R Craigie, and K. Mizuuchi. 1987. B protein of bacteriophage Mu is an ATPasethat preferentially stimulates intermolecular DNA strand transfer. Proc. Natl. Acad. Sci. USA 84:699-703. 36. Meyer, R. J., and J. A. Shapiro. 1980. Genetic organization of the broad-host-range IncP-1 plasmid R751. J. Bacteriol. 143:1362- 1373. 37. Miller, J. L., S. K. Anderson, D. J. Fujita, G. Chaconas, D. L. Baldwin, and R. M. Harshey. 1984. The nucleotide sequence of the B gene of bacteriophage Mu. Nucleic Acids Res. 12:8627- 8638. 38. Mizuuchi, K. 1992. Transpositional recombination: mechanistic insights from studies of Mu and other elements. Annu. Rev. Biochem. 61:1011-1051. 39. Nucken, E. J., R. B. Henschke, and F. R. J. Schmidt. 1989. Nucleotide sequence of an OXA-2 1-lactamase gene from the R-plasmid R1767 derived plasmid pBP11 and comparison to closely related resistance determinants found in R46 and Tn2603. J. Gen. Microbiol. 135:761-765. 40. Ollis, D. L., P. Brick, R. Hamlin, N. G. Xuong, and T. A. Steitz. 1985. Structure of large fragment of Escherichia coli DNA poly- merase I complexed with dTMP. Nature (London) 313:762-766. 41. Ouellette, M., L. Bissonnette, and P. H. Roy. 1987. Precise insertion of antibiotic resistance determinants into Tn2l-like transposons: nucleotide sequencing of the OXA-1 1-lactamase gene. Proc. Natl. Acad. Sci. USA 84:7378-7382. 42. Ouellette, M., and P. H. Roy. 1987. Homology of ORFs from Tn2603 and from R46 to site-specific recombinases. Nucleic Acids Res. 15:10055. 43. Pabo, C. 1984. Protein-DNA recognition. Annu. Rev. Biochem. 53:293-321. 44. Pansegrau, W., and E. Lanka. 1987. Conservation of a common "backbone" in the genetic organization of the IncP plasmids RP4 and R751. Nucleic Acids Res. 15:2385. 45. Paulsen, I. T., T. G. Littlejohn, P. Radstrom, L. Sundstrom, O. Skold, G. Swedberg, and R. A. Skurray. 1993. The 3' conserved segment of integrons contains a gene associated with multidrug resistance to antiseptics and disinfectants. Antimicrob. Agents Chemother. 37:761-768. 46. Plasterk, R H. A., A. Brinkman, and P. van de Putte. 1983. DNA inversions in the chromosome of Escherichia coli and in bacterio- phage Mu: relationship to other site-specific recombination sys- tems. Proc. Natl. Acad. Sci. USA 80:5355-5358. 47. RAdstrom, P., G. Swedberg, and 0. Skold. 1991. Genetic analyses of sulfonamide resistance and its dissemination in gram-negative bacteria illustrate new aspects ofR plasmid evolution. Antimicrob. Agents Chemother. 35:1840-1848. 48. Rogers, M., N. Ekaterinaki, E. Nimmo, and D. Sherratt. 1986. Analysis of Tn7 transposition. Mol. Gen. Genet. 205:550-556. 49. Rowland, S.-J., and K. G. H. Dyke. 1990. Tn552, a novel transpos- able element from Staphylococcus aureus. Mol. Microbiol. 4:961- 975. 50. Sambrook, J., E. F. Fritsch, and T. Maniatis. 1989. Molecular cloning: a laboratory manual. Cold Spring Harbor Press, Cold VOL. 176, 1994 o n Septem ber 28, 2017 by guest http://jb.asm.org/ D ow nloaded from 3268 RADSTROM ET AL. Spring Harbor, N.Y. 51. Sancar, A., and J. E. Hearst. 1993. Molecular matchmakers. Science 259:1415-1420. 52. Sanger, F., S. Nicklen, and A. R Coulson. 1977. DNA sequencing with chain terminating inhibitors. Proc. Natl. Acad. Sci. USA 74:5463-5467. 53. Shapiro, J. A. 1979. Molecular model for the transposition and replication of bacteriophage Mu and other transposable elements. Proc. Natl. Acad. Sci. USA 76:1933-1937. 54. Shapiro, J. A., and P. Sporn. 1977. Tn4O2: a new transposable element determining trimethoprim resistance that inserts in bac- teriophage lambda. J. Bacteriol. 129:1632-1635. 55. Stark, W. M., M. R. Boocock, and D. J. Sherratt. 1989. Site-specific recombination by Tn3 resolvase. Trends Genet. 5:304-309. 56. Stokes, H. W., and R M. Hall. 1989. A novel family of potentially mobile DNA elements encoding site-specific gene-integration functions: integrons. Mol. Microbiol. 3:1669-1683. 56a.Sundstrom, L., P. RAdstrom, 0. Skold, J. Flensburg, K. Hansson, and G. Swedberg. 1991. Program Abstr. 31th Intersci. Conf. Antimicrob. Agents Chemother., abstr. 1363. 57. Sundstrom, L., P. RAdstrom, G. Swedberg, and 0. Skold. 1988. Site-specific recombination promotes linkage between tri- methoprim- and sulfonamide resistance genes. Sequence charac- terization of dhfrV and sulI and a recombination active locus of Tn2l. Mol. Gen. Genet. 213:191-201. 58. Sundstrom, L., P. H. Roy, and 0. Skold. 1991. Site-specific insertion of three structural gene cassettes in transposon Tn7. J. Bacteriol. 173:3025-3028. 59. Sundstrom, L., and 0. Skold. 1990. The dhfrI trimethoprim resistance gene can be found at specific sites in other genetic surroundings. Antimicrob. Agents Chemother. 34:642-650. 60. Sundstrom, L., G. Swedberg, and 0. Skbld. 1993. Characterization of transposon TnSO86, carrying the site-specifically inserted gene dhfrVII mediating trimethoprim resistance. J. Bacteriol. 175:1796- 1805. 61. Surette, M. G., T. Harkness, and G. Chaconas. 1991. Stimulation of the Mu A protein-mediated strand cleavage reaction by the Mu B protein, and the requirement of DNA nicking for stable type 1 transpososome formation. J. Biol. Chem. 266:3118-3124. 62. Swift, G., B. J. MacCarthy, and F. Hefron. 1981. DNA sequence of a plasmid-encoded dihydrofolate reductase. Mol. Gen. Genet. 181:441-447. 63. Varmus, H., and P. Brown. 1989. Retroviruses, p. 53-108. In D. E. Berg and M. M. Howe (ed.), Mobile DNA. American Society for Microbiology, Washington, D.C. 64. Ward, J. M., and J. Grinsted. 1982. Physical and genetic analysis of the Inc-W group plasmids R388, Sa and R7K. Plasmid 7:239-250. 65. Yanisch-Perron, C., J. Vieira, and J. Messing. 1985. Improved M13 phage cloning vectors and host strains: nucleotide sequences of the M13mpl8 and pUC19 vectors. Gene 33:103-119. J. BACTERIOL. o n Septem ber 28, 2017 by guest http://jb.asm.org/ D ow nloaded from
Compartilhar